CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: Serine (or cysteine) proteinase inhibitor, clade a (alpha-1 antiproteinase, antitrypsin), member 1
    Symbol: SERPINA1
    Organism: Homo sapiens
    NCBI Accession: NP_000286
    SubstrateDB: 3579
    UniProt Accession: P01009
    [Sequence on/off]
    MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSN
    STNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGN
    GLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVN
    YIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPD
    EGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAP
    LKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK

    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: PFVF-LMIE
    Position: 396-397
    Protease
    Definition: matrix metallopeptidase-7
    Organism: Homo sapiens
    NCBI GI: 4505219
    MEROPS ID: MER001092
    PMAP ID: pmap.41956
    MEROPS code: M10.008
    Original citation
    Acknowledgment
    HPRD
    Comments and others