CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: Monocyte chemoattractant protein (mcp-3)
    Symbol:
    Organism: Homo sapiens
    NCBI Accession: CAA50405
    SubstrateDB: 3654
    UniProt Accession: Q7Z7Q8
    [Sequence on/off]
    MWKPMPSPSNMKASAALLCLLLTAAAFSPQGLAQPVGINTSTTCCYRFINKKIPKQRLESYRRTTSSHCP
    REAVIFKTKLDKEICADPTQKWVQDFMKHLDKKTQTPKL
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: QPVG-INTS
    Position: 37-38
    Protease
    Definition: matrix metallopeptidase-13
    Organism: Homo sapiens
    NCBI GI: 4505209
    MEROPS ID: MER001411
    PMAP ID: pmap.44672
    MEROPS code: M10.013
    Original citation
    Acknowledgment
    HPRD
    Comments and others