CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: Endothelin 1
    Symbol: EDN1
    Organism: Homo sapiens
    NCBI Accession: NP_001946
    SubstrateDB: 3735
    [Sequence on/off]
    MDYLLMIFSLLFVACQGAPETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMDKECVYFCHLD
    IIWVNTPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRAEDIMEKDWN
    NHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSETMRNSVKSSFHDPKLKGNPSRERYVTHNRA
    HW
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: TPEH-VVPY
    Position: 79-80
    Protease
    Definition: endothelin-converting enzyme 1
    Organism: Homo sapiens
    NCBI GI: 4503443
    MEROPS ID: MER001057
    PMAP ID: pmap.41815
    MEROPS code: M13.002
    Original citation
    Acknowledgment
    HPRD
    Comments and others