CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: Bh3 interacting domain death agonist isoform 2
    Symbol: BID
    Organism: Homo sapiens
    NCBI Accession: NP_001187
    SubstrateDB: 3867
    UniProt Accession: P55957
    [Sequence on/off]
    MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLG
    RIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPR
    DMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: LQTD-GNRS
    Position: 60-61
    Protease
    Definition: caspase-2
    Organism: Homo sapiens
    NCBI GI: 39995059
    MEROPS code: C14.006
    Original citation
    Acknowledgment
    HPRD_mod
    Comments and others