CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: Kiss-1 metastasis-suppressor
    Symbol: KISS1
    Organism: Homo sapiens
    NCBI Accession: NP_002247
    SubstrateDB: 3880
    UniProt Accession: Q15726
    [Sequence on/off]
    MNSLVSWQLLLFLCATHFGEPLEKVASVGNSRPTGQQLESLGLLAPGEQSLPCTERKPAATARLSRRGTS
    LSPPPESSGSPQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRFGKREAAPGNHGRSAGRGWG
    AGAGQ
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: NSFG-LRFG
    Position: 118-119
    Protease
    Definition: membrane-type matrix metallopeptidase-1
    Organism: Homo sapiens
    NCBI GI: 4826834
    MEROPS code: M10.014
    Original citation
    Acknowledgment
    HPRD
    Comments and others