CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: Matrix metalloproteinase 9 preproprotein
    Symbol: MMP9
    Organism: Homo sapiens
    NCBI Accession: NP_004985
    SubstrateDB: 4042
    [Sequence on/off]
    MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPA
    LLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDA
    FARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELW
    SLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQD
    GNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFP
    FTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMY
    PMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPS
    AGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKW
    PALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGR
    RLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYD
    ILQCPED
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: TLKA-MRTP
    Position: 93-94
    Protease
    Definition: matrix metallopeptidase-26
    Organism: Homo sapiens
    NCBI GI: 73808266
    MEROPS ID: MER012072
    PMAP ID: pmap.06772
    MEROPS code: M10.029
    Consequence
    Activation_complete
    Original citation
    Acknowledgment
    HPRD
    Comments and others